PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 881982
Common NameARALYDRAFT_681426
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 630aa    MW: 70911.9 Da    PI: 7.3526
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
881982genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.41.1e-22127228199
             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
             f kvlt sd++++g +++p+k+a e+     ++++   ++l  +d++g++W++k++yr+++ r+++t+GW+ F  +++L +gD++vF   + +++el+v+++r
  881982 127 FTKVLTASDTSAHGGFSVPRKHAIEClpplnMSEPLPAQELLTTDLQGNQWRFKHSYRGTPPRHLITTGWNAFTTSKKLVAGDVIVFL--RGECGELRVGIRR 227
             89****************************8445555668999*********************************************..449*********9 PP

             S CS
      B3  99 k 99 
             +
  881982 228 A 228
             6 PP

2Auxin_resp94.31.9e-31253334183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++++++F vv +P+  +s+F+v+++k+++a+++k+ vG+Rf m+fe++d serr+sGt++gv+d++p +W +S+WrsL+
      881982 253 AVHAFDNQCMFIVVCKPSIRSSQFIVSYDKFLDAVNKKFNVGSRFTMRFEGDDLSERRYSGTIIGVKDFSP-HWIESEWRSLE 334
                 799********************************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-35117240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.97E-29118250IPR015300DNA-binding pseudobarrel domain
CDDcd100177.01E-21126227No hitNo description
SMARTSM010191.3E-19127229IPR003340B3 DNA binding domain
PfamPF023624.6E-20127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.731127229IPR003340B3 DNA binding domain
PfamPF065077.5E-28253333IPR010525Auxin response factor
PfamPF023094.0E-10524611IPR033389AUX/IAA domain
SuperFamilySSF542772.89E-11530608No hitNo description
PROSITE profilePS5174526.083532615IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MESGNVVNAQ PELSGITVDE SKSYMYEQLW KLCAGPLYDI PKVGEKVYYF PQGHIEILSL  60
SLSLSLSLSL SLSLSLSLSL SRVIAIQLKV EKNSDETYAE ITLMPYTTQV VIHNQNDNHY  120
RPSVNSFTKV LTASDTSAHG GFSVPRKHAI ECLPPLNMSE PLPAQELLTT DLQGNQWRFK  180
HSYRGTPPRH LITTGWNAFT TSKKLVAGDV IVFLRGECGE LRVGIRRAGH QQGNRPSSLI  240
SIDSMGHGVI ASAVHAFDNQ CMFIVVCKPS IRSSQFIVSY DKFLDAVNKK FNVGSRFTMR  300
FEGDDLSERR YSGTIIGVKD FSPHWIESEW RSLEVKFSFT LYNIILRVKW DEFASFPRPD  360
KVSPWEIEHL TPLSNVLRSS LLKNKRSREV NEIGSTSSHL LPPISTQDQE IGQPSMIYPM  420
NVLPSYRDAT EDAEIPSRLL ISYPVPTMPK LTYNNNQMVT PLEKNITTNA SASCRLFGVS  480
LATPSEIKDP IDQQDSYQIS EISKLSQEKK FGLGQTLTSA REIQSKQLSS TRSCTKVQME  540
GVTVGRALDL SVLNGYDQLI LELEKLFDLN GQLQTRNQWE ISFIDNEGDK MFVGDDPWPE  600
FCNMVKRIII YTKEKVKNLK SEQSLKLNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-10913771362Auxin response factor 1
4ldw_A1e-10913771362Auxin response factor 1
4ldw_B1e-10913771362Auxin response factor 1
4ldx_A1e-10913771362Auxin response factor 1
4ldx_B1e-10913771362Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891224.10.0predicted protein
SwissprotQ9LQE80.0ARFN_ARATH; Putative auxin response factor 14
TrEMBLD7KM300.0D7KM30_ARALL; Auxin response factor
STRINGAl_scaffold_0001_37490.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35540.10.0auxin response factor 14